HORDB

ID: hor006755
Uniprot ID: Q3YC03
Protein name: Glycoprotein hormones alpha chain
Gene name: CGA
Organism: Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Family: Glycoprotein hormones subunit alpha family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Saimiri boliviensis (species), Saimiri (genus), Saimiriinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex; GO:0061696 pituitary gonadotropin complex

Sequence: LPEGEFTTEECPECKLKENKYFSKLGTPIYQCTGCCFSRAYPTPFRSQKTMLVPKNVTSESSCCVAKAYTKATVMGNVKVENHTECHCSTCYYHKF
Length: 96
Propeptide: MDSYRKYAAIILVTLSVFLHILHSLPEGEFTTEECPECKLKENKYFSKLGTPIYQCTGCCFSRAYPTPFRSQKTMLVPKNVTSESSCCVAKAYTKATVMGNVKVENHTECHCSTCYYHKF
Signal peptide: MDSYRKYAAIILVTLSVFLHILHS
Modification: NA
Glycosylation: T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006755_AF2.pdb

hor006755_ESM.pdb

Mass:	1257913	Formula:	C475H732N124O145S12
Absent amino acids:	DW	Common amino acids:	TCK
pI:	8.08	Basic residues:	15
Polar residues:	42	Hydrophobic residues:	20
Hydrophobicity:	-49.48	Boman Index:	-15892
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	42.6
Instability Index:	6486.56	Extinction Coefficient cystines:	9565
Absorbance 280nm:	100.68